DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and hand2

DIOPT Version :10

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_571701.3 Gene:hand2 / 58150 ZFINID:ZDB-GENE-000511-1 Length:205 Species:Danio rerio


Alignment Length:143 Identity:43/143 - (30%)
Similarity:69/143 - (48%) Gaps:30/143 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 HHLQANPLGKNQGRS----------PRY---W--NKQQRSKPYDKLSTSMSSSTSSASSS----- 124
            ||    |:..:.|.|          |.|   |  :..:.|.|...::.|.|...|:.:..     
Zfish     9 HH----PVMHHDGYSFAAASRCHEEPPYFHGWLISHPEMSPPDYTMAPSYSPEYSTGAPGLDHSH 69

  Fly   125 -----SSSSAGFGGEVLKKRRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQ 184
                 .:.:.|.|...: |||..||.:||||..|:|.||.:||:.:|::..|.:|||.:||::|.
Zfish    70 YGGVPGAGAVGMGPRTV-KRRPTANRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLAT 133

  Fly   185 AYIGDLVTLLSRD 197
            :||..|:.:|.:|
Zfish   134 SYIAYLMDILDKD 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 bHLH_TS_amos_like 132..195 CDD:381558 27/62 (44%)
hand2NP_571701.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..103 11/27 (41%)
bHLH_TS_HAND2 88..149 CDD:381477 27/59 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..194
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.