DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and bhlhe23

DIOPT Version :9

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001025304.1 Gene:bhlhe23 / 559796 ZFINID:ZDB-GENE-050913-22 Length:227 Species:Danio rerio


Alignment Length:181 Identity:56/181 - (30%)
Similarity:71/181 - (39%) Gaps:54/181 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LSNDTFQQLEQLMYQQEFSTSDSQSDGA-NSCSLEMYYDTPSVLELEHMLNAQEQQQHHLQANPL 87
            :||||...|.|...|..|........|: ...||     ||:                   |:.|
Zfish    12 ISNDTLLDLTQRYGQSAFGFGAGHGAGSPGRFSL-----TPA-------------------ADFL 52

  Fly    88 GKNQGRSPRYWNKQQRSKP--YDKLSTSMSSSTSSASSSSSSSAGFG-----GEVLKKR------ 139
            ....|:|.....:|...:.  :|.|            .|....|||.     |.:.||.      
Zfish    53 SGQTGKSNESGGEQTSDEDDGFDNL------------ESRKRGAGFDEEKHPGSLTKKSKEQRSL 105

  Fly   140 RLAANARERRRMNSLNDAFDKLRDVVPSLGHD---RRLSKYETLQMAQAYI 187
            ||:.||||||||:.||||.|.||.|:| ..|.   |:|||..||.:|:.||
Zfish   106 RLSINARERRRMHDLNDALDGLRSVIP-YAHSPSVRKLSKIATLLLAKNYI 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 HLH 137..195 CDD:238036 31/60 (52%)
bhlhe23NP_001025304.1 HLH 110..164 CDD:197674 27/47 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578695
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.