DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and Olig1

DIOPT Version :9

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_058664.2 Gene:Olig1 / 50914 MGIID:1355334 Length:260 Species:Mus musculus


Alignment Length:107 Identity:37/107 - (34%)
Similarity:49/107 - (45%) Gaps:38/107 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 SSASSSSSSSAGF-----------------------GG--------EVLKKRRLAANARERRRMN 152
            ||:||||||:|..                       ||        :..::.|...|:|||:||.
Mouse    44 SSSSSSSSSTASLLPKPAREKAEAPLAEPRGPAPESGGARADAKEEQQQQQLRRKINSRERKRMQ 108

  Fly   153 SLNDAFDKLRDVV-P-SLGH-----DRRLSKYETLQMAQAYI 187
            .||.|.|.||:|: | |..|     .|:|||..||.:|:.||
Mouse   109 DLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYI 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 HLH 137..195 CDD:238036 26/58 (45%)
Olig1NP_058664.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..104 14/59 (24%)
HLH 96..153 CDD:278439 26/55 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835480
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.