DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and Olig2

DIOPT Version :10

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_058663.2 Gene:Olig2 / 50913 MGIID:1355331 Length:323 Species:Mus musculus


Alignment Length:95 Identity:42/95 - (44%)
Similarity:56/95 - (58%) Gaps:14/95 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 PYDKL--------STSMSSSTSSASSSSS--SSAGFGGEVLKKRRLAANARERRRMNSLNDAFDK 160
            |.|||        |:|.|||||||::||:  .........|::.||..|:|||:||:.||.|.|.
Mouse    66 PGDKLGGGGFKSSSSSTSSSTSSAATSSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNIAMDG 130

  Fly   161 LRDVVPSLGHD---RRLSKYETLQMAQAYI 187
            ||:|:| ..|.   |:|||..||.:|:.||
Mouse   131 LREVMP-YAHGPSVRKLSKIATLLLARNYI 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 bHLH_TS_amos_like 132..195 CDD:381558 27/59 (46%)
Olig2NP_058663.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..107 15/40 (38%)
bHLH_TS_OLIG2 95..179 CDD:381510 27/66 (41%)

Return to query results.
Submit another query.