DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and NEUROG3

DIOPT Version :9

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_066279.2 Gene:NEUROG3 / 50674 HGNCID:13806 Length:214 Species:Homo sapiens


Alignment Length:92 Identity:33/92 - (35%)
Similarity:44/92 - (47%) Gaps:20/92 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 RSKPYDKLSTSMSSSTSSASSSSSSSAGFGGEVLKKRRLAANARERRRMNSLNDAFDKLRDVVPS 167
            ||:|..:|:.|...                    :.||..||.|||.||::||.|.|.||.|:|:
Human    68 RSRPKSELALSKQR--------------------RSRRKKANDRERNRMHNLNSALDALRGVLPT 112

  Fly   168 LGHDRRLSKYETLQMAQAYIGDLVTLL 194
            ...|.:|:|.|||:.|..||..|...|
Human   113 FPDDAKLTKIETLRFAHNYIWALTQTL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 HLH 137..195 CDD:238036 28/58 (48%)
NEUROG3NP_066279.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..98 14/49 (29%)
HLH 81..140 CDD:238036 28/79 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145424
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.