powered by:
Protein Alignment amos and Neurod6
DIOPT Version :9
Sequence 1: | NP_477446.1 |
Gene: | amos / 35110 |
FlyBaseID: | FBgn0003270 |
Length: | 198 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001102707.1 |
Gene: | Neurod6 / 500137 |
RGDID: | 1562793 |
Length: | 337 |
Species: | Rattus norvegicus |
Alignment Length: | 61 |
Identity: | 33/61 - (54%) |
Similarity: | 41/61 - (67%) |
Gaps: | 0/61 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 134 EVLKKRRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYIGDLVTLL 194
|.:|.||..||||||.||:.||||.|.||.|||.....::|||.|||::|:.||..|..:|
Rat 90 ERVKFRRQEANARERNRMHGLNDALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEIL 150
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
amos | NP_477446.1 |
HLH |
137..195 |
CDD:238036 |
32/58 (55%) |
Neurod6 | NP_001102707.1 |
HLH |
100..151 |
CDD:197674 |
28/51 (55%) |
Neuro_bHLH |
153..272 |
CDD:315246 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C166339086 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.840 |
|
Return to query results.
Submit another query.