DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and olig3

DIOPT Version :9

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001008191.1 Gene:olig3 / 493553 XenbaseID:XB-GENE-919789 Length:263 Species:Xenopus tropicalis


Alignment Length:161 Identity:49/161 - (30%)
Similarity:67/161 - (41%) Gaps:49/161 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 STSDSQSDGANSCSLEMYYDTPSVLELEH-----MLNAQEQQQHHLQ---ANPLGKN----QGRS 94
            |.|.|.|..|:|..:|..|     |...|     |.:....|...||   ...|.|:    :|.|
 Frog     3 SDSSSMSSRASSPDMEDMY-----LRSHHRPDNRMSSVSSTQNDMLQKMSEEMLSKHGSRGEGES 62

  Fly    95 PRYWNKQQRSKPYDKLSTSMSSSTSSASSSSSSSAGFGGEVLKKRRLAANARERRRMNSLNDAFD 159
            .:|..|:|.|:                            :.|::.||..|.|||:||:.||.|.|
 Frog    63 SKYKIKKQLSE----------------------------QDLQQLRLKINGRERKRMHDLNLAMD 99

  Fly   160 KLRDVVPSLGHD---RRLSKYETLQMAQAYI 187
            .||:|:| ..|.   |:|||..||.:|:.||
 Frog   100 GLREVMP-YAHGPSVRKLSKIATLLLARNYI 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 HLH 137..195 CDD:238036 26/54 (48%)
olig3NP_001008191.1 bHLH_SF 64..144 CDD:381792 31/95 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.