DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment amos and NEUROG1

DIOPT Version :9

Sequence 1:	NP_477446.1	Gene:	amos / 35110	FlyBaseID:	FBgn0003270	Length:	198	Species:	Drosophila melanogaster
Sequence 2:	NP_006152.2	Gene:	NEUROG1 / 4762	HGNCID:	7764	Length:	237	Species:	Homo sapiens

Alignment Length:	132	Identity:	38/132 - (28%)
Similarity:	55/132 - (41%)	Gaps:	36/132 - (27%)

- Green bases have known domain annotations that are detailed below.

  Fly    63 PSVLELEHMLNAQEQQQHHLQANPLGKNQGRSPRYWNKQQRSKPYDKLSTSMSSSTSSASSSSSS 127
            |::.....:..||:.:|...:..  |:.:.||....:..:||
Human    53 PNISRASEVPGAQDDEQERRRRR--GRTRVRSEALLHSLRRS----------------------- 92

  Fly   128 SAGFGGEVLKKRRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYIGDLVT 192
                       ||:.||.|||.||::||.|.|.||.|:||...|.:|:|.|||:.|..||..|..
Human    93 -----------RRVKANDRERNRMHNLNAALDALRSVLPSFPDDTKLTKIETLRFAYNYIWALAE 146

  Fly   193 LL 194
            .|
Human   147 TL 148

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
amos	NP_477446.1	HLH	137..195	CDD:238036	29/58 (50%)
NEUROG1	NP_006152.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	35..83		6/31 (19%)
		HLH	90..149	CDD:238036	31/93 (33%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	175..209
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165145404
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.840