DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and tx

DIOPT Version :9

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001287543.1 Gene:tx / 43190 FlyBaseID:FBgn0263118 Length:384 Species:Drosophila melanogaster


Alignment Length:160 Identity:44/160 - (27%)
Similarity:67/160 - (41%) Gaps:35/160 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 YDTPSVLELEHMLNAQEQQQHHLQANPLGKNQGRSPRYWNKQQRSK-----------------PY 107
            |:..:..:|..|..|.:.:....:...    ..|..:|..:|:|.|                 ..
  Fly     6 YELHNYADLNDMARATDSKDSRKRKTA----SARGEKYSLRQKRQKRGSNEDGESANLADFQLEL 66

  Fly   108 DKLSTSMSSSTSSASSSSSSSAGFGGEVLKKRRLAANARERRRMNSLNDAFDKLRDVVPSL--GH 170
            |.::...|.|..:|.:.|.:.|   ..:.|.||..||||||.||..:|.||:.||..||..  |.
  Fly    67 DPIAEPASKSRKNAPTKSKTKA---PPLSKYRRKTANARERTRMREINTAFETLRHCVPEAIKGE 128

  Fly   171 D-----RRLSKYETLQMAQAYIGDLVTLLS 195
            |     .:|:|..||::|..||    |:|:
  Fly   129 DAANTNEKLTKITTLRLAMKYI----TMLT 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 HLH 137..195 CDD:238036 28/64 (44%)
txNP_001287543.1 HLH 95..154 CDD:278439 27/62 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.