DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and Fer3

DIOPT Version :10

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster


Alignment Length:99 Identity:44/99 - (44%)
Similarity:58/99 - (58%) Gaps:5/99 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 WNKQQRSKPYDKLSTSMSSSTSSASSSSSSSAGFGGEVLK-KRRLAANARERRRMNSLNDAFDKL 161
            |.:.|    ...|.....|:...|:.|||||......|.. .:|.|||.||||||.:||:|||||
  Fly    49 WQRSQ----VTPLVPQRPSTNGRANGSSSSSKKTRRRVASMAQRRAANIRERRRMFNLNEAFDKL 109

  Fly   162 RDVVPSLGHDRRLSKYETLQMAQAYIGDLVTLLS 195
            |..||:..:::|||:.|||::|..|||.:..|||
  Fly   110 RRKVPTFAYEKRLSRIETLRLAITYIGFMAELLS 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 bHLH_TS_amos_like 132..195 CDD:381558 32/63 (51%)
Fer3NP_524322.1 bHLH_TS_FERD3L_NATO3 79..142 CDD:381421 31/62 (50%)

Return to query results.
Submit another query.