DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and nhlh2

DIOPT Version :10

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_991232.1 Gene:nhlh2 / 402968 ZFINID:ZDB-GENE-040426-1809 Length:122 Species:Danio rerio


Alignment Length:62 Identity:26/62 - (41%)
Similarity:37/62 - (59%) Gaps:8/62 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 KKRRLAANA--------RERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYIGDL 190
            |:||..|.|        |||.|:.:.|.||.:||.::|:|..|::|||.|.|::|..||..|
Zfish    55 KRRRRRATAKYRSAHATRERIRVEAFNVAFAELRKLLPTLPPDKKLSKIEILRLAICYISYL 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 bHLH_TS_amos_like 132..195 CDD:381558 26/62 (42%)
nhlh2NP_991232.1 bHLH_SF 50..122 CDD:469605 26/62 (42%)

Return to query results.
Submit another query.