powered by:
Protein Alignment amos and Bhlhe22
DIOPT Version :9
Sequence 1: | NP_477446.1 |
Gene: | amos / 35110 |
FlyBaseID: | FBgn0003270 |
Length: | 198 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001102410.1 |
Gene: | Bhlhe22 / 365748 |
RGDID: | 1305451 |
Length: | 352 |
Species: | Rattus norvegicus |
Alignment Length: | 73 |
Identity: | 35/73 - (47%) |
Similarity: | 43/73 - (58%) |
Gaps: | 9/73 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 123 SSSSSSAGFGGEVLKKR-----RLAANARERRRMNSLNDAFDKLRDVVPSLGHD---RRLSKYET 179
:|.|...|.||...|.: ||..||||||||:.||||.|:||.|:| ..|. |:|||..|
Rat 193 TSGSGGNGGGGSSKKSKEQKALRLNINARERRRMHDLNDALDELRAVIP-YAHSPSVRKLSKIAT 256
Fly 180 LQMAQAYI 187
|.:|:.||
Rat 257 LLLAKNYI 264
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
amos | NP_477446.1 |
HLH |
137..195 |
CDD:238036 |
30/59 (51%) |
Bhlhe22 | NP_001102410.1 |
HLH |
219..273 |
CDD:197674 |
27/47 (57%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C166339101 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.840 |
|
Return to query results.
Submit another query.