DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and Bhlhe22

DIOPT Version :9

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001102410.1 Gene:Bhlhe22 / 365748 RGDID:1305451 Length:352 Species:Rattus norvegicus


Alignment Length:73 Identity:35/73 - (47%)
Similarity:43/73 - (58%) Gaps:9/73 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 SSSSSSAGFGGEVLKKR-----RLAANARERRRMNSLNDAFDKLRDVVPSLGHD---RRLSKYET 179
            :|.|...|.||...|.:     ||..||||||||:.||||.|:||.|:| ..|.   |:|||..|
  Rat   193 TSGSGGNGGGGSSKKSKEQKALRLNINARERRRMHDLNDALDELRAVIP-YAHSPSVRKLSKIAT 256

  Fly   180 LQMAQAYI 187
            |.:|:.||
  Rat   257 LLLAKNYI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 HLH 137..195 CDD:238036 30/59 (51%)
Bhlhe22NP_001102410.1 HLH 219..273 CDD:197674 27/47 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339101
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.