DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and Atoh7

DIOPT Version :10

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001163953.1 Gene:Atoh7 / 365564 RGDID:1304957 Length:149 Species:Rattus norvegicus


Alignment Length:84 Identity:47/84 - (55%)
Similarity:58/84 - (69%) Gaps:4/84 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 SSASSSSSSSAGFGG-EVLKKRRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQM 182
            :.|:..:.|.||.|. |...:|||||||||||||..||.|||:||.|||..|.|::|||||||||
  Rat    21 AGAAERAVSCAGPGRLESAARRRLAANARERRRMQGLNTAFDRLRRVVPQWGQDKKLSKYETLQM 85

  Fly   183 AQAYIGDLVTLLS---RDY 198
            |.:||..|..:|:   ||:
  Rat    86 ALSYIVALTRILAEAERDW 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 bHLH_TS_amos_like 132..195 CDD:381558 40/63 (63%)
Atoh7NP_001163953.1 bHLH_TS_ATOH7 35..102 CDD:381557 40/66 (61%)

Return to query results.
Submit another query.