DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and hlh-32

DIOPT Version :10

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001023430.1 Gene:hlh-32 / 3565279 WormBaseID:WBGene00013665 Length:105 Species:Caenorhabditis elegans


Alignment Length:50 Identity:25/50 - (50%)
Similarity:33/50 - (66%) Gaps:2/50 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 RLAANARERRRMNSLNDAFDKLRDVVPSL--GHDRRLSKYETLQMAQAYI 187
            ||:.|.|||.||:.||:|.|.||.|:|..  |..|:|||..||.:|:.:|
 Worm    16 RLSINLRERCRMHDLNEALDDLRAVIPYAHGGSVRKLSKIATLLLAKNHI 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 bHLH_TS_amos_like 132..195 CDD:381558 24/49 (49%)
hlh-32NP_001023430.1 bHLH_TS_bHLHe22_like 16..77 CDD:381474 24/49 (49%)

Return to query results.
Submit another query.