DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and Oli

DIOPT Version :9

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster


Alignment Length:122 Identity:46/122 - (37%)
Similarity:64/122 - (52%) Gaps:20/122 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 ANPLGKNQGRSPRYWNKQQRSKPYDKLS--------TSMSSSTSSASSSSSSSAGFGGEVLKKR- 139
            |..:|.:| :.|...||...|.|...||        .::|..|::.:.||..::|.|....|:: 
  Fly    60 AQGMGMSQ-QPPTDENKPGPSAPEKPLSPTAAAIAAIAISGGTTTVAVSSGGASGSGSNSGKQKN 123

  Fly   140 ------RLAANARERRRMNSLNDAFDKLRDVVPSLGHD---RRLSKYETLQMAQAYI 187
                  ||..||||||||:.||||.|:||.|:| ..|.   |:|||..||.:|:.||
  Fly   124 RQGKTVRLNINARERRRMHDLNDALDELRSVIP-YAHSPSVRKLSKIATLLLAKNYI 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 HLH 137..195 CDD:238036 30/61 (49%)
OliNP_001188830.1 HLH 134..188 CDD:197674 27/47 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446157
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.