DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and ascl1a

DIOPT Version :10

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_571294.1 Gene:ascl1a / 30466 ZFINID:ZDB-GENE-980526-90 Length:196 Species:Danio rerio


Alignment Length:123 Identity:37/123 - (30%)
Similarity:57/123 - (46%) Gaps:27/123 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 NKQQRSKP---YDKLSTSMSSSTSSASSSSSSS---------------------AGFGGEVLKKR 139
            |:||...|   :...|..:|.:.|..|:.|:|.                     ||||..:.:::
Zfish    12 NQQQFMPPACFFASQSIQLSPTDSQCSNKSASKQAKRQRSSSPELLRCKRRLNFAGFGYSLPQQQ 76

  Fly   140 RLAA---NARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYIGDLVTLL 194
            ..|.   |.|||.|:..:|:.|..||:.||:...::::||.|||:.|..||..|..||
Zfish    77 PHAVARRNERERNRVKLVNNGFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLL 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 bHLH_TS_amos_like 132..195 CDD:381558 24/66 (36%)
ascl1aNP_571294.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..54 4/20 (20%)
bHLH_TS_ASCL1_Mash1 75..145 CDD:381585 23/60 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..186
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.