DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and atoh1a

DIOPT Version :9

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_571166.2 Gene:atoh1a / 30303 ZFINID:ZDB-GENE-990415-17 Length:292 Species:Danio rerio


Alignment Length:178 Identity:61/178 - (34%)
Similarity:81/178 - (45%) Gaps:48/178 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 MYYDTPSVLEL--EHMLNAQEQQQHHLQANPLGKNQGRSPRYW---------------------- 98
            |..||..|:||  :|....:.:|..:..|  |.......||.|                      
Zfish     4 MSTDTREVVELDVQHSSLGRGEQSEYPPA--LALMASSDPRAWLAPVQAGTCAAHAEYLLHSPGS 66

  Fly    99 ---------NKQQRSKPYDKL--------STSMSSSTSSASSSSSSSAGFGGEVLKKRRLAANAR 146
                     |.::.||...|:        :.........|.||.|::.     |.|:||:|||||
Zfish    67 SAEGVSSASNFRKSSKSPVKVRELCRLKGAVGADEGRQRAPSSKSTNV-----VQKQRRMAANAR 126

  Fly   147 ERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYIGDLVTLL 194
            |||||:.||.|||:||.|:|:..:|::|||||||||||.||..|..||
Zfish   127 ERRRMHGLNHAFDELRSVIPAFDNDKKLSKYETLQMAQIYINALSDLL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 HLH 137..195 CDD:238036 39/58 (67%)
atoh1aNP_571166.2 HLH 117..175 CDD:238036 39/58 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578686
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2611
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.