powered by:
Protein Alignment amos and neurod1
DIOPT Version :9
Sequence 1: | NP_477446.1 |
Gene: | amos / 35110 |
FlyBaseID: | FBgn0003270 |
Length: | 198 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_571053.1 |
Gene: | neurod1 / 30169 |
ZFINID: | ZDB-GENE-990415-172 |
Length: | 350 |
Species: | Danio rerio |
Alignment Length: | 58 |
Identity: | 31/58 - (53%) |
Similarity: | 40/58 - (68%) |
Gaps: | 0/58 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 137 KKRRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYIGDLVTLL 194
|.||:.||||||.||:.||||.:.||.|||.....::|||.|||::|:.||..|..:|
Zfish 95 KMRRMKANARERNRMHGLNDALESLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEIL 152
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170578678 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2611 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.870 |
|
Return to query results.
Submit another query.