DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and Neurog1

DIOPT Version :9

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_062080.1 Gene:Neurog1 / 29410 RGDID:3167 Length:244 Species:Rattus norvegicus


Alignment Length:175 Identity:51/175 - (29%)
Similarity:65/175 - (37%) Gaps:51/175 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EFSTSDSQSDGANSCSLEMYYDTPSVLELEHMLNAQEQQQHHLQANPLGKNQGRSPRYWNKQQRS 104
            |...||.....:||.|     |..|.|       ..|:....||  ||....|            
  Rat     6 ETCLSDLDCASSNSGS-----DLSSFL-------TDEEDCARLQ--PLASTSG------------ 44

  Fly   105 KPYDKLSTSMSSSTSSASSSSSSSAGFGGE--------------------VLKKRRLAANARERR 149
                 ||.....|..:.|.:|:...|...|                    :.:.||:.||.|||.
  Rat    45 -----LSVPARRSAPTLSGASNVPGGQDEEQERRRRRGRARVRSEALLHSLRRSRRVKANDRERN 104

  Fly   150 RMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYIGDLVTLL 194
            ||::||.|.|.||.|:||...|.:|:|.|||:.|..||..|...|
  Rat   105 RMHNLNAALDALRSVLPSFPDDTKLTKIETLRFAYNYIWALAETL 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 HLH 137..195 CDD:238036 29/58 (50%)
Neurog1NP_062080.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..84 8/57 (14%)
bHLH_TS_NGN1_NeuroD3 83..154 CDD:381559 29/67 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339093
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.