DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and Neurod4

DIOPT Version :9

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001099412.2 Gene:Neurod4 / 288821 RGDID:1310434 Length:330 Species:Rattus norvegicus


Alignment Length:155 Identity:49/155 - (31%)
Similarity:69/155 - (44%) Gaps:31/155 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 EMYYDTPSVLELEHMLNAQEQQQHHLQANPLGKNQGRSPRYWNKQQRSKP--YDKLSTSMSSSTS 119
            :||..:..::||   :|.|...           ::|.|.:...::|..:|  |..|.|.|....|
  Rat     3 KMYMKSKDMVEL---VNTQSWM-----------DKGLSSQNEMEEQERRPGSYGMLGTLMEEHDS 53

  Fly   120 SASSSSSSSAG----FGGEVLKK-----------RRLAANARERRRMNSLNDAFDKLRDVVPSLG 169
            ..........|    ..|...||           ||:.||||||.||:.||||.|.||.|:|...
  Rat    54 IEEEEEEEEDGDKPKRRGPKKKKMTKARLERFRARRVKANARERTRMHGLNDALDNLRRVMPCYS 118

  Fly   170 HDRRLSKYETLQMAQAYIGDLVTLL 194
            ..::|||.|||::|:.||..|..:|
  Rat   119 KTQKLSKIETLRLARNYIWALSEVL 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 HLH 137..195 CDD:238036 32/69 (46%)
Neurod4NP_001099412.2 bHLH_TS_NeuroD4_ATOH3 59..145 CDD:381564 34/85 (40%)
Neuro_bHLH 146..263 CDD:403655
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339113
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.