DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and BHLHE22

DIOPT Version :9

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_689627.1 Gene:BHLHE22 / 27319 HGNCID:11963 Length:381 Species:Homo sapiens


Alignment Length:76 Identity:40/76 - (52%)
Similarity:48/76 - (63%) Gaps:4/76 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 SSSTSSASSSSSSSAGFGGEVLKKRRLAANARERRRMNSLNDAFDKLRDVVPSLGHD---RRLSK 176
            |.|.|..|||||||:....:..|..||..||||||||:.||||.|:||.|:| ..|.   |:|||
Human   219 SGSGSGGSSSSSSSSSKKSKEQKALRLNINARERRRMHDLNDALDELRAVIP-YAHSPSVRKLSK 282

  Fly   177 YETLQMAQAYI 187
            ..||.:|:.||
Human   283 IATLLLAKNYI 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 HLH 137..195 CDD:238036 30/54 (56%)
BHLHE22NP_689627.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..94
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 135..154
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..242 10/22 (45%)
HLH 248..302 CDD:197674 27/47 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145412
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.