DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and neurod4

DIOPT Version :9

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_739568.2 Gene:neurod4 / 266958 ZFINID:ZDB-GENE-030730-1 Length:348 Species:Danio rerio


Alignment Length:154 Identity:45/154 - (29%)
Similarity:69/154 - (44%) Gaps:32/154 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SQSDGANSCSL---EMYYDTPSVLEL--EHMLNAQEQQQHHLQANPLGKNQGRSPRYWNKQQRSK 105
            |..||..:..:   .::......||:  |.|...:|:::.    ..:|.:..::|:      |..
Zfish    27 SSQDGDRTPEIGHYSLHRSNRGPLEIGSEDMDEEEEEEED----EEMGLDGEKAPK------RRG 81

  Fly   106 PYDKLSTSMSSSTSSASSSSSSSAGFGGEVLKKRRLAANARERRRMNSLNDAFDKLRDVVPSLGH 170
            |..|..|....                 |..:.||:.||||||.||:.||||.|.||.|:|....
Zfish    82 PKKKKMTKARQ-----------------ERFRARRIKANARERSRMHGLNDALDNLRRVMPCYSK 129

  Fly   171 DRRLSKYETLQMAQAYIGDLVTLL 194
            .::|||.|||::|:.||..|..:|
Zfish   130 TQKLSKIETLRLARNYIWALSEVL 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 HLH 137..195 CDD:238036 30/58 (52%)
neurod4NP_739568.2 HLH 98..154 CDD:238036 30/56 (54%)
Neuro_bHLH 156..272 CDD:289310
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578692
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2611
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.