DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and PTF1A

DIOPT Version :10

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_835455.1 Gene:PTF1A / 256297 HGNCID:23734 Length:328 Species:Homo sapiens


Alignment Length:62 Identity:32/62 - (51%)
Similarity:45/62 - (72%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 LKKRRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYIGDLVTLLSRD 197
            |::.|.|||.||||||.|:||||:.||..:|:|.:::||||.:||::|..||..|..|:..|
Human   161 LQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQAD 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 bHLH_TS_amos_like 132..195 CDD:381558 31/58 (53%)
PTF1ANP_835455.1 bHLH_TS_PTF1A 165..219 CDD:381423 29/53 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..278
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..328
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.