DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and Ascl2

DIOPT Version :10

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_113691.1 Gene:Ascl2 / 24209 RGDID:2159 Length:260 Species:Rattus norvegicus


Alignment Length:94 Identity:36/94 - (38%)
Similarity:47/94 - (50%) Gaps:9/94 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 QRSKPYDKLSTSMSSSTSSASSSSSSSAGFGGEVLKKRRLAANARERRRMNSLNDAFDKLRDVVP 166
            :|..|..:|........|.|:.:|||||...      ||   |.|||.|:..:|..|..||..||
  Rat    91 RRRPPSPELLRCSRRRRSGATEASSSSAAVA------RR---NERERNRVKLVNLGFQALRQHVP 146

  Fly   167 SLGHDRRLSKYETLQMAQAYIGDLVTLLS 195
            ..|.:::|||.|||:.|..||..|..||:
  Rat   147 HGGANKKLSKVETLRSAVEYIRALQRLLA 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 bHLH_TS_amos_like 132..195 CDD:381558 25/62 (40%)
Ascl2NP_113691.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..126 13/43 (30%)
bHLH_TS_ASCL2_Mash2 128..180 CDD:381586 21/48 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..239
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.