DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and Tcf15

DIOPT Version :10

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:XP_006499163.1 Gene:Tcf15 / 21407 MGIID:104664 Length:262 Species:Mus musculus


Alignment Length:72 Identity:34/72 - (47%)
Similarity:47/72 - (65%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 SSSSSSAGFGGEVLKKRRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYI 187
            |...:|.|.|..|:.::|.|||||||.|..|:|.||..||.::|:...||:|||.|||::|.:||
Mouse   122 SGRRASNGAGPVVVVRQRQAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYI 186

  Fly   188 GDLVTLL 194
            ..|..:|
Mouse   187 AHLANVL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 bHLH_TS_amos_like 132..195 CDD:381558 31/63 (49%)
Tcf15XP_006499163.1 bHLH_TS_TCF15_paraxis 131..196 CDD:381476 31/63 (49%)

Return to query results.
Submit another query.