DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and Tal2

DIOPT Version :10

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_033343.1 Gene:Tal2 / 21350 MGIID:99540 Length:108 Species:Mus musculus


Alignment Length:56 Identity:27/56 - (48%)
Similarity:39/56 - (69%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 RRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYIGDLVTLL 194
            |::..|.|||.|..|:|:||.|||.::|:...|::|||.|||::|..||..||.:|
Mouse     3 RKIFTNTRERWRQQSVNNAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVL 58

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 bHLH_TS_amos_like 132..195 CDD:381558 27/56 (48%)
Tal2NP_033343.1 bHLH_SF 2..62 CDD:469605 27/56 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..108
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.