DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and lin-32

DIOPT Version :9

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_508410.2 Gene:lin-32 / 191703 WormBaseID:WBGene00003018 Length:142 Species:Caenorhabditis elegans


Alignment Length:144 Identity:50/144 - (34%)
Similarity:73/144 - (50%) Gaps:38/144 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 EQQQHHL-QANPLGKNQGRSPRYWNKQQRSKPYDKLSTSMSSSTSSASSSSSS-----SAGFGG- 133
            ||.|.:: |.:|....||                .:.::|::...|.:.|..|     |...|| 
 Worm     4 EQYQMYVPQCHPSFMYQG----------------SIQSTMTTPLQSPNFSLDSPNYPDSLSNGGG 52

  Fly   134 ---------------EVLKKRRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMA 183
                           ::|:.||.|||.|||||||:||.|:|:||:|:|.:...::|||:||||||
 Worm    53 KDDKKKCRRYKTPSPQLLRMRRSAANERERRRMNTLNVAYDELREVLPEIDSGKKLSKFETLQMA 117

  Fly   184 QAYIGDLVTLLSRD 197
            |.||..|..:|.:|
 Worm   118 QKYIECLSQILKQD 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 HLH 137..195 CDD:238036 33/57 (58%)
lin-32NP_508410.2 HLH 73..124 CDD:278439 32/50 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167232
Domainoid 1 1.000 68 1.000 Domainoid score I6373
eggNOG 1 0.900 - - E1_KOG4395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003687
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR19290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2611
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.