DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and hlh-12

DIOPT Version :10

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_501445.1 Gene:hlh-12 / 182980 WormBaseID:WBGene00001956 Length:150 Species:Caenorhabditis elegans


Alignment Length:49 Identity:20/49 - (40%)
Similarity:31/49 - (63%) Gaps:0/49 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 RRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYI 187
            ||..||.|||:|::.:|..||.|.:::|......|||:.:.|:.|.:||
 Worm    14 RRSRANERERQRVSEMNGMFDVLLNLLPPSHFKTRLSRVQILREATSYI 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 bHLH_TS_amos_like 132..195 CDD:381558 20/49 (41%)
hlh-12NP_501445.1 HLH 14..66 CDD:459628 20/49 (41%)

Return to query results.
Submit another query.