DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and hlh-8

DIOPT Version :10

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_509367.1 Gene:hlh-8 / 181069 WormBaseID:WBGene00001953 Length:178 Species:Caenorhabditis elegans


Alignment Length:66 Identity:28/66 - (42%)
Similarity:39/66 - (59%) Gaps:8/66 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 GGEVLKK-------RRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYIGD 189
            |..|::|       :|..||.|||:|...|||||..||.::||:..| ::||..||::|..||..
 Worm     7 GERVVRKNEVENVQQRACANRRERQRTKELNDAFTLLRKLIPSMPSD-KMSKIHTLRIATDYISF 70

  Fly   190 L 190
            |
 Worm    71 L 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 bHLH_TS_amos_like 132..195 CDD:381558 28/66 (42%)
hlh-8NP_509367.1 bHLH_TS_TWIST 21..79 CDD:381470 25/52 (48%)

Return to query results.
Submit another query.