DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and Neurod2

DIOPT Version :9

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_035025.3 Gene:Neurod2 / 18013 MGIID:107755 Length:383 Species:Mus musculus


Alignment Length:134 Identity:42/134 - (31%)
Similarity:63/134 - (47%) Gaps:26/134 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 PSVLEL--EHMLNAQEQQQHHLQANPLGKNQGRSPRYWNKQQRSKPYDKLSTSMSSSTSSASSSS 125
            |::.|:  |..|..:|:::.. :...|.:.:|..|:....::|.....:|..|            
Mouse    69 PTLAEVKEEGELGGEEEEEEE-EEEGLDEAEGERPKKRGPKKRKMTKARLERS------------ 120

  Fly   126 SSSAGFGGEVLKKRRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYIGDL 190
                       |.||..||||||.||:.||.|.|.||.|||.....::|||.|||::|:.||..|
Mouse   121 -----------KLRRQKANARERNRMHDLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWAL 174

  Fly   191 VTLL 194
            ..:|
Mouse   175 SEIL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 HLH 137..195 CDD:238036 31/58 (53%)
Neurod2NP_035025.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..130 16/84 (19%)
bHLH_TS_NeuroD2 89..181 CDD:381563 37/114 (32%)
Nuclear localization signal. /evidence=ECO:0000255 108..114 1/5 (20%)
Neuro_bHLH 181..311 CDD:372170
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835484
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.