DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and Neurod1

DIOPT Version :9

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_035024.1 Gene:Neurod1 / 18012 MGIID:1339708 Length:357 Species:Mus musculus


Alignment Length:147 Identity:41/147 - (27%)
Similarity:57/147 - (38%) Gaps:39/147 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 LGKNQGRSPRYWNKQQRSKPYDKLSTSMSSSTSSASSSSSSSAGFGGEV---------------- 135
            :|:.|.:.|..|..:..|...::...........|.::...|...|||.                
Mouse    11 MGEPQPQGPPSWTDECLSSQDEEHEADKKEDELEAMNAEEDSLRNGGEEEEEDEDLEEEEEEEEE 75

  Fly   136 -----------------------LKKRRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKY 177
                                   .|.||:.||||||.||:.||.|.|.||.|||.....::|||.
Mouse    76 EEDQKPKRRGPKKKKMTKARLERFKLRRMKANARERNRMHGLNAALDNLRKVVPCYSKTQKLSKI 140

  Fly   178 ETLQMAQAYIGDLVTLL 194
            |||::|:.||..|..:|
Mouse   141 ETLRLAKNYIWALSEIL 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 HLH 137..195 CDD:238036 31/58 (53%)
Neurod1NP_035024.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..94 10/82 (12%)
Nuclear localization signal. /evidence=ECO:0000255 87..93 0/5 (0%)
HLH 100..158 CDD:238036 31/58 (53%)
Neuro_bHLH 160..284 CDD:289310
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835482
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2611
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.