DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and Ascl1

DIOPT Version :10

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_032579.2 Gene:Ascl1 / 17172 MGIID:96919 Length:231 Species:Mus musculus


Alignment Length:135 Identity:41/135 - (30%)
Similarity:63/135 - (46%) Gaps:23/135 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 NAQEQQ-----QHHLQANPLGKNQ-----GRSPRYWNKQQRSKPYDKLSTSMSSSTSSASSSSSS 127
            :||:||     |...|.:|:..:|     .:|.....|:|||          ||..........:
Mouse    45 SAQQQQPQAPPQQAPQLSPVADSQPSGGGHKSAAKQVKRQRS----------SSPELMRCKRRLN 99

  Fly   128 SAGFGGEVLKKRRLAA---NARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYIGD 189
            .:|||..:.:::..|.   |.|||.|:..:|..|..||:.||:...::::||.|||:.|..||..
Mouse   100 FSGFGYSLPQQQPAAVARRNERERNRVKLVNLGFATLREHVPNGAANKKMSKVETLRSAVEYIRA 164

  Fly   190 LVTLL 194
            |..||
Mouse   165 LQQLL 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 bHLH_TS_amos_like 132..195 CDD:381558 24/66 (36%)
Ascl1NP_032579.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..92 15/56 (27%)
bHLH_TS_ASCL1_Mash1 110..180 CDD:381585 23/60 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.