DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and BHLHA15

DIOPT Version :10

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_803238.1 Gene:BHLHA15 / 168620 HGNCID:22265 Length:189 Species:Homo sapiens


Alignment Length:118 Identity:42/118 - (35%)
Similarity:64/118 - (54%) Gaps:12/118 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 QANPLGK--NQGRSPRYWNKQQRSKPYDKLSTSMSSSTSSASSSSSSSAGFGG--EVLKKRRLAA 143
            :..|.|.  |.|..|.   |..||:|    :.:.:.:...........:|.||  :...:|||.:
Human    23 EGTPDGSLPNPGPEPA---KGLRSRP----ARAAARAPGEGRRRRPGPSGPGGRRDSSIQRRLES 80

  Fly   144 NARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYIGDL-VTLLS 195
            |.|||:||:.||:||..||:|:|.:..|::|||.|||.:|:.||..| .|:|:
Human    81 NERERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLAKNYIKSLTATILT 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 bHLH_TS_amos_like 132..195 CDD:381558 31/65 (48%)
BHLHA15NP_803238.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..85 17/68 (25%)
bHLH_TS_MIST1 76..137 CDD:381554 30/58 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..189
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.