DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and Hand1

DIOPT Version :10

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_032239.1 Gene:Hand1 / 15110 MGIID:103577 Length:216 Species:Mus musculus


Alignment Length:90 Identity:31/90 - (34%)
Similarity:56/90 - (62%) Gaps:3/90 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 STSMSSSTSSASSSSSSSAG---FGGEVLKKRRLAANARERRRMNSLNDAFDKLRDVVPSLGHDR 172
            :|:::::.....:..|.|.|   ..|..|.||:.:...:||||..|:|.||.:||:.:|::..|.
Mouse    64 TTAVAAAAYGPDARPSQSPGRLEALGSRLPKRKGSGPKKERRRTESINSAFAELRECIPNVPADT 128

  Fly   173 RLSKYETLQMAQAYIGDLVTLLSRD 197
            :|||.:||::|.:||..|:.:|::|
Mouse   129 KLSKIKTLRLATSYIAYLMDVLAKD 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 bHLH_TS_amos_like 132..195 CDD:381558 25/62 (40%)
Hand1NP_032239.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..109 12/44 (27%)
bHLH_TS_HAND1 94..153 CDD:381522 24/58 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..203
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.