DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and Twist2

DIOPT Version :9

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_031881.1 Gene:Twist2 / 13345 MGIID:104685 Length:160 Species:Mus musculus


Alignment Length:105 Identity:39/105 - (37%)
Similarity:59/105 - (56%) Gaps:4/105 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 RSPRYWNKQQRSKPYDKLSTSMSSSTSSASSSSSSSAGFGGEVLKKRRLAANARERRRMNSLNDA 157
            |.|:.:.:::|   |.|.|:...|.|........|.:....|.|:.:|:.||.|||:|..|||:|
Mouse    24 RQPKRFGRKRR---YSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEA 85

  Fly   158 FDKLRDVVPSLGHDRRLSKYETLQMAQAYIGDLVTLLSRD 197
            |..||.::|:|..| :|||.:||::|..||..|..:|..|
Mouse    86 FAALRKIIPTLPSD-KLSKIQTLKLAARYIDFLYQVLQSD 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 HLH 137..195 CDD:238036 26/57 (46%)
Twist2NP_031881.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63 9/41 (22%)
bHLH_TS_TWIST2 51..132 CDD:381543 31/75 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5351
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.