DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and TWIST2

DIOPT Version :10

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_476527.1 Gene:TWIST2 / 117581 HGNCID:20670 Length:160 Species:Homo sapiens


Alignment Length:105 Identity:39/105 - (37%)
Similarity:59/105 - (56%) Gaps:4/105 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 RSPRYWNKQQRSKPYDKLSTSMSSSTSSASSSSSSSAGFGGEVLKKRRLAANARERRRMNSLNDA 157
            |.|:.:.:::|   |.|.|:...|.|........|.:....|.|:.:|:.||.|||:|..|||:|
Human    24 RQPKRFGRKRR---YSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEA 85

  Fly   158 FDKLRDVVPSLGHDRRLSKYETLQMAQAYIGDLVTLLSRD 197
            |..||.::|:|..| :|||.:||::|..||..|..:|..|
Human    86 FAALRKIIPTLPSD-KLSKIQTLKLAARYIDFLYQVLQSD 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 bHLH_TS_amos_like 132..195 CDD:381558 28/62 (45%)
TWIST2NP_476527.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63 9/41 (22%)
bHLH_TS_TWIST2 51..132 CDD:381543 31/75 (41%)

Return to query results.
Submit another query.