DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and OLIG1

DIOPT Version :10

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_620450.2 Gene:OLIG1 / 116448 HGNCID:16983 Length:271 Species:Homo sapiens


Alignment Length:124 Identity:44/124 - (35%)
Similarity:56/124 - (45%) Gaps:43/124 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 YDKLSTSMSSSTSSASSSSSSS----------------------------AGFGG--------EV 135
            |.:..:|.||||||.||:||||                            |..||        |.
Human    38 YRQPPSSSSSSTSSTSSTSSSSTTAPLLPKAAREKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQ 102

  Fly   136 LKKRRLAANARERRRMNSLNDAFDKLRDVV-P-SLGH-----DRRLSKYETLQMAQAYI 187
            .::.|...|:|||:||..||.|.|.||:|: | |..|     .|:|||..||.:|:.||
Human   103 QQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYI 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 bHLH_TS_amos_like 132..195 CDD:381558 29/71 (41%)
OLIG1NP_620450.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..117 23/78 (29%)
bHLH_TS_OLIG1 101..175 CDD:381512 27/61 (44%)

Return to query results.
Submit another query.