DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and neurod2

DIOPT Version :9

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_571157.1 Gene:neurod2 / 114435 ZFINID:ZDB-GENE-010608-3 Length:363 Species:Danio rerio


Alignment Length:58 Identity:30/58 - (51%)
Similarity:37/58 - (63%) Gaps:0/58 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 KKRRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYIGDLVTLL 194
            |.||..||||||.||:.||.|.|.|..|||.....::|||.|||::|:.||..|..:|
Zfish   106 KVRRQKANARERTRMHDLNSALDNLLKVVPCYSKTQKLSKIETLRLAKNYIWALSEIL 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 HLH 137..195 CDD:238036 30/58 (52%)
neurod2NP_571157.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..116 6/9 (67%)
Nuclear localization signal. /evidence=ECO:0000255 93..99
HLH 105..164 CDD:238036 30/58 (52%)
Neuro_bHLH 166..285 CDD:289310
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578680
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.