DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and OLIG2

DIOPT Version :10

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_005797.1 Gene:OLIG2 / 10215 HGNCID:9398 Length:323 Species:Homo sapiens


Alignment Length:95 Identity:43/95 - (45%)
Similarity:56/95 - (58%) Gaps:14/95 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 PYDKLSTS-MSSSTSSASSSSSSSAGFGGEVLKKR---------RLAANARERRRMNSLNDAFDK 160
            |.|||..| ..||:||.|||:||:|....:..||:         ||..|:|||:||:.||.|.|.
Human    66 PGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNIAMDG 130

  Fly   161 LRDVVPSLGHD---RRLSKYETLQMAQAYI 187
            ||:|:| ..|.   |:|||..||.:|:.||
Human   131 LREVMP-YAHGPSVRKLSKIATLLLARNYI 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 bHLH_TS_amos_like 132..195 CDD:381558 28/68 (41%)
OLIG2NP_005797.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..107 17/40 (43%)
bHLH_TS_OLIG2 95..179 CDD:381510 28/66 (42%)

Return to query results.
Submit another query.