DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and atoh1c

DIOPT Version :9

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:XP_003199618.1 Gene:atoh1c / 100498672 ZFINID:ZDB-GENE-090805-1 Length:204 Species:Danio rerio


Alignment Length:131 Identity:52/131 - (39%)
Similarity:71/131 - (54%) Gaps:28/131 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 QEQQQHHLQANPLGKNQGRSPRYWNKQQRSKPYDKLS-----------TSMSSSTSSASSSSSSS 128
            :|..:.|.:..|      ::|..|.::|..   |:.|           |.:|.|:...||.:.:.
Zfish    14 RETDRSHSEQCP------KAPMGWREEQLQ---DRASCDPCALVQLRLTGLSYSSEEQSSIARAR 69

  Fly   129 AGFGGEVLKKRRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYIGDLVTL 193
                    ::|||||||||||||..||.|||:||.|:|::..||:|||.|||||||.||..|..|
Zfish    70 --------RRRRLAANARERRRMLGLNVAFDRLRSVIPNVESDRKLSKSETLQMAQIYISTLSEL 126

  Fly   194 L 194
            |
Zfish   127 L 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 HLH 137..195 CDD:238036 39/58 (67%)
atoh1cXP_003199618.1 HLH 87..129 CDD:197674 26/41 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578684
Domainoid 1 1.000 77 1.000 Domainoid score I8781
eggNOG 1 0.900 - - E1_KOG4395
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5240
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003687
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.