DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and neurog1

DIOPT Version :9

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001116895.1 Gene:neurog1 / 100144651 XenbaseID:XB-GENE-491452 Length:227 Species:Xenopus tropicalis


Alignment Length:130 Identity:42/130 - (32%)
Similarity:64/130 - (49%) Gaps:15/130 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 YDTPSVLELEHMLNAQEQQQHHLQ-ANPLGKNQGRSPRYW-NKQQRSKPYDKLSTSMSSSTSSAS 122
            |:|.|.:.   ..::.|:....:| |:|.......||... .|.|..|  ||....:.|...:.:
 Frog     8 YETCSQMS---YCSSDEEDSFSMQSASPFSSEHMSSPAQTPEKCQEEK--DKRKKRVRSRVKNDA 67

  Fly   123 SSSSSSAGFGGEVLKKRRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYI 187
            ...:        :.|.||:.||.|||.||::||.|.|:||.::||...|.:|:|.|||::|..||
 Frog    68 VLHT--------IKKTRRVKANDRERNRMHNLNSALDELRGILPSFPDDTKLTKIETLRLAHNYI 124

  Fly   188  187
             Frog   125  124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 HLH 137..195 CDD:238036 27/51 (53%)
neurog1NP_001116895.1 HLH 73..132 CDD:238036 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.