DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and hand2

DIOPT Version :10

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001093695.1 Gene:hand2 / 100101704 XenbaseID:XB-GENE-481426 Length:210 Species:Xenopus tropicalis


Alignment Length:105 Identity:37/105 - (35%)
Similarity:62/105 - (59%) Gaps:9/105 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 QRSKPYDKLSTSMSSSTSSASSSSSSS-------AGFGGEVLK--KRRLAANARERRRMNSLNDA 157
            :.|.|...::.|.|...::.::....|       :|.||.:.:  |||..||.:||||..|:|.|
 Frog    47 EMSPPDYSMAPSYSPEYANGAAGLDHSHYGGVPGSGAGGLMQRPVKRRGTANRKERRRTQSINSA 111

  Fly   158 FDKLRDVVPSLGHDRRLSKYETLQMAQAYIGDLVTLLSRD 197
            |.:||:.:|::..|.:|||.:||::|.:||..|:.||::|
 Frog   112 FAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKD 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 bHLH_TS_amos_like 132..195 CDD:381558 29/64 (45%)
hand2NP_001093695.1 bHLH_TS_HAND2 93..154 CDD:381477 28/59 (47%)

Return to query results.
Submit another query.