DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment amos and neurog3

DIOPT Version :9

Sequence 1:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster
Sequence 2:XP_002935814.2 Gene:neurog3 / 100038294 XenbaseID:XB-GENE-876279 Length:226 Species:Xenopus tropicalis


Alignment Length:150 Identity:43/150 - (28%)
Similarity:69/150 - (46%) Gaps:50/150 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 EMYYD-------------TPSVLELEHMLNAQEQQQHHL---QANPLGKNQGRSPRYWNKQQRSK 105
            |:||:             ||     :..|:..|.:...|   .::|.|..:        |:|:.|
 Frog    17 ELYYEISDNEVPPFSPPCTP-----DSQLSLAESEDCTLVDGYSHPRGNER--------KKQKVK 68

  Fly   106 PYDKLSTSMSSSTSSASSSSSSSAGFGGEVLKK---RRLAANARERRRMNSLNDAFDKLRDVVPS 167
               ::.:.:.|:|:               |:|:   ||:.||.|||.||::||.|.|.||.|:|:
 Frog    69 ---RMRSKVKSNTT---------------VIKQRRNRRVKANDRERNRMHNLNSALDALRSVLPT 115

  Fly   168 LGHDRRLSKYETLQMAQAYI 187
            ...|.:|:|.|||:.|..||
 Frog   116 FPDDAKLTKIETLRFAHNYI 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
amosNP_477446.1 HLH 137..195 CDD:238036 26/53 (49%)
neurog3XP_002935814.2 bHLH_TS_NGN3_ATOH5 80..147 CDD:381561 27/55 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.