DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15160 and Rprd1b

DIOPT Version :9

Sequence 1:NP_001286047.1 Gene:CG15160 / 35109 FlyBaseID:FBgn0032688 Length:834 Species:Drosophila melanogaster
Sequence 2:NP_001278063.1 Gene:Rprd1b / 70470 MGIID:1917720 Length:326 Species:Mus musculus


Alignment Length:325 Identity:76/325 - (23%)
Similarity:144/325 - (44%) Gaps:64/325 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TFDEELFETRLEALKDTQEGIQQMSNWCLQHRSNHKKIIQCWLNVFKRVRVDHRLVLFYLANDVI 68
            :|.|...|.:|..|.::|:.:|.:|.|.:.||.:...|:..|....::.:.:.:|...|||||||
Mouse     3 SFSESALEKKLSELSNSQQSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTFLYLANDVI 67

  Fly    69 QYSKRKRYEFVECWATALQRATTMV---RDERVKDKILRIFKIWEQREIYNEEYLSDLSGLLNI- 129
            |.||||..||...:.:.|..|.:.|   .||..|..:.|:..||::|.:|..|::..|.  |:: 
Mouse    68 QNSKRKGPEFTREFESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYGGEFIQQLK--LSME 130

  Fly   130 ---APPKKS--------------QVDVSDEFQNA--------------TLIAQVRECVELAEITD 163
               :||.|:              |.:..|::..:              .||..:::....|....
Mouse   131 DSKSPPPKAAEEKKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIKALQDLENAASGDA 195

  Fly   164 KSMQKLPKPPTFEIEVIK--QQLKDKSHSGNIEKEVERCVAFINAYNKNLQNEIKSRKAVLASIE 226
            ...||:...|. |::.:.  :::.||..:..:.|.|:.....:..||..|..|::.|:      :
Mouse   196 TVRQKIASLPQ-EVQDVSLLEKITDKEAAERLSKTVDEACLLLAEYNGRLAAELEDRR------Q 253

  Fly   227 AAKKFYEHQGKEVKVVA------SAYKSFGTRIKIVKRKLD---ETIPNLA---------SPIPS 273
            .|:...|:...:.:|::      ..||....|:..|:::|.   :::|:|:         :|:||
Mouse   254 LARMLVEYTQNQKEVLSEKEKKLEEYKQKLARVTQVRKELKSHIQSLPDLSLLPNVTGGLAPLPS 318

  Fly   274  273
            Mouse   319  318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15160NP_001286047.1 RPR 10..128 CDD:214731 39/120 (33%)
Rprd1bNP_001278063.1 CID_RPRD1B 3..131 CDD:340809 42/129 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..148 3/19 (16%)
CREPT 178..324 CDD:406870 29/148 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2669
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000693
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12460
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1901
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.