DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15160 and rprd1b

DIOPT Version :9

Sequence 1:NP_001286047.1 Gene:CG15160 / 35109 FlyBaseID:FBgn0032688 Length:834 Species:Drosophila melanogaster
Sequence 2:NP_001004796.1 Gene:rprd1b / 448020 XenbaseID:XB-GENE-949983 Length:325 Species:Xenopus tropicalis


Alignment Length:321 Identity:73/321 - (22%)
Similarity:140/321 - (43%) Gaps:57/321 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TFDEELFETRLEALKDTQEGIQQMSNWCLQHRSNHKKIIQCWLNVFKRVRVDHRLVLFYLANDVI 68
            :|.|...|.:|..|.::|:.:|.:|.|.:.||.:...|:..|....::.:...:|...|||||||
 Frog     3 SFTEPALEKKLSELSNSQQSVQTLSLWLIHHRKHAASIVTVWQRELRKAKSSRKLTFLYLANDVI 67

  Fly    69 QYSKRKRYEFVECWATALQRATTMVRDER---VKDKILRIFKIWEQREIYNEEYLSDLS-GLLNI 129
            |.||||..||...:...|..|.:.|..|.   .:..:.|:..||::|.:|:.:::..|. .:.|.
 Frog    68 QNSKRKGPEFTREFENVLLDAFSHVSSEAEDGCRKPLERLLHIWQERSVYSADFIQQLRLSIEND 132

  Fly   130 APPKKSQVDVSDEFQNATLIAQVRECVE----------------LAEITDKSMQKLPKPPTFEIE 178
            ..|:  :..|::|........|::|..:                |.|...|::|.|....:.:..
 Frog   133 ESPR--ETPVNEEKSLKRTFQQIQEEDDDYPGNYSPRDTSAGPLLTEDLIKALQDLENAASGDAA 195

  Fly   179 V---------------IKQQLKDKSHSGNIEKEVERCVAFINAYNKNLQNEIKSR----KAVLAS 224
            |               :.:::.||..:..:.|.|:.....:..||..|..|:..|    |.::..
 Frog   196 VRQKIASLPQEVQDVSLLEKITDKEAAERLSKTVDEACILLAEYNGRLAAELDDRRQLAKMLMEY 260

  Fly   225 IEAAKKFYEHQGKEVKVVASAYKSFGTRIKIVKRKLD---ETIPNLA---------SPIPS 273
            .:|.|:...::.|:::    .||....|:..|:::|.   :::|:|:         :|:||
 Frog   261 TQAQKETLSNKEKKLE----EYKQKLARVTQVRKELKSHIQSLPDLSLLPNVTGGLAPLPS 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15160NP_001286047.1 RPR 10..128 CDD:214731 36/121 (30%)
rprd1bNP_001004796.1 CID_RPRD1B 3..131 CDD:340809 38/127 (30%)
CREPT 177..322 CDD:374635 28/145 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091009at2759
OrthoFinder 1 1.000 - - FOG0000693
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12460
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1901
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.