DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15160 and Rprd1b

DIOPT Version :9

Sequence 1:NP_001286047.1 Gene:CG15160 / 35109 FlyBaseID:FBgn0032688 Length:834 Species:Drosophila melanogaster
Sequence 2:NP_001092197.1 Gene:Rprd1b / 311591 RGDID:1304782 Length:326 Species:Rattus norvegicus


Alignment Length:325 Identity:76/325 - (23%)
Similarity:144/325 - (44%) Gaps:64/325 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TFDEELFETRLEALKDTQEGIQQMSNWCLQHRSNHKKIIQCWLNVFKRVRVDHRLVLFYLANDVI 68
            :|.|...|.:|..|.::|:.:|.:|.|.:.||.:...|:..|....::.:.:.:|...|||||||
  Rat     3 SFSESALEKKLSELSNSQQSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTFLYLANDVI 67

  Fly    69 QYSKRKRYEFVECWATALQRATTMV---RDERVKDKILRIFKIWEQREIYNEEYLSDLSGLLNI- 129
            |.||||..||...:.:.|..|.:.|   .||..|..:.|:..||::|.:|..|::..|.  |:: 
  Rat    68 QNSKRKGPEFTREFESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYGGEFIQQLK--LSME 130

  Fly   130 ---APPKKS--------------QVDVSDEFQNA--------------TLIAQVRECVELAEITD 163
               :||.|:              |.:..|::..:              .||..:::....|....
  Rat   131 DSKSPPPKAAEEKKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIKALQDLENAASGDA 195

  Fly   164 KSMQKLPKPPTFEIEVIK--QQLKDKSHSGNIEKEVERCVAFINAYNKNLQNEIKSRKAVLASIE 226
            ...||:...|. |::.:.  :::.||..:..:.|.|:.....:..||..|..|::.|:      :
  Rat   196 TVRQKIASLPQ-EVQDVSLLEKITDKEAAERLSKTVDEACLLLAEYNGRLAAELEDRR------Q 253

  Fly   227 AAKKFYEHQGKEVKVVA------SAYKSFGTRIKIVKRKLD---ETIPNLA---------SPIPS 273
            .|:...|:...:.:|::      ..||....|:..|:::|.   :::|:|:         :|:||
  Rat   254 LARMLVEYTQNQKEVLSEKEKKLEEYKQKLARVTQVRKELKSHIQSLPDLSLLPNVTGGLAPLPS 318

  Fly   274  273
              Rat   319  318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15160NP_001286047.1 RPR 10..128 CDD:214731 39/120 (33%)
Rprd1bNP_001092197.1 CID_RPRD1B 3..131 CDD:340809 42/129 (33%)
CREPT 178..324 CDD:406870 29/148 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2669
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091009at2759
OrthoFinder 1 1.000 - - FOG0000693
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12460
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.