DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15160 and Rprd1a

DIOPT Version :9

Sequence 1:NP_001286047.1 Gene:CG15160 / 35109 FlyBaseID:FBgn0032688 Length:834 Species:Drosophila melanogaster
Sequence 2:NP_001347736.1 Gene:Rprd1a / 225283 MGIID:2385066 Length:312 Species:Mus musculus


Alignment Length:334 Identity:89/334 - (26%)
Similarity:148/334 - (44%) Gaps:63/334 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDEELFETRLEALKDTQEGIQQMSNWCLQHRSNHKKIIQCWLNVFKRVRVDHRLVLFYLANDVIQ 69
            |.|...|.:|..|.::|:.:|.:|.|.:.||.:.:.|:..|....::.:.:.:|...||||||||
Mouse     4 FSEAALEKKLSELSNSQQSVQTLSLWLIHHRKHSRPIVTVWERELRKAKPNRKLTFLYLANDVIQ 68

  Fly    70 YSKRKRYEFVECWATALQRATTMV---RDERVKDKILRIFKIWEQREIYNEEYLSDLSGLLNIAP 131
            .||||..||.:.:|..:..|...|   .||..|..:.|:..|||:|.:|..:.|..|...|  ..
Mouse    69 NSKRKGPEFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKHAL--YG 131

  Fly   132 PKKS------QVDVSDEFQNATLIAQVRECVELAEITDKSMQKL-----------PKPPTFEIEV 179
            .||:      |:.| ||.:|.:.:....|..:..::. :::|.|           .:..:..:||
Mouse   132 DKKARKRTYEQIKV-DENENCSSLGSPSEPPQTLDLV-RALQDLENAASGDAAVHQRIASLPVEV 194

  Fly   180 ----IKQQLKDKSHSGNIEKEVERCVAFINAYNKNLQNEIKSRKAVLASI--------EA-AKKF 231
                :.:::.||.....:.|.||.....:..||..|..||..||.:...:        || |:| 
Mouse   195 QEVSLLEKITDKESGERLSKMVEDACMLLADYNGRLAAEIDDRKQLTRMLADFLRCQKEALAEK- 258

  Fly   232 YEHQGKEVKVVASAYKSFGTRIKIVKRKLDETIPNLASPIPSPDVNAPSPERDADLQLPEENNIP 296
             ||:.:|       ||....|:.:|:::|...|.:|      ||::          :||......
Mouse   259 -EHKLEE-------YKRKLARVSLVRKELRARIQSL------PDLS----------RLPNVTGSH 299

  Fly   297 LNL-FGGSI 304
            ::| |.|.|
Mouse   300 MHLPFAGDI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15160NP_001286047.1 RPR 10..128 CDD:214731 40/120 (33%)
Rprd1aNP_001347736.1 CID_RPRD1A 4..131 CDD:340808 43/128 (34%)
CREPT 165..309 CDD:374635 38/170 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2669
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091009at2759
OrthoFinder 1 1.000 - - FOG0000693
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12460
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1901
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.