DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde11 and Pde9a

DIOPT Version :9

Sequence 1:NP_001286044.1 Gene:Pde11 / 35107 FlyBaseID:FBgn0085370 Length:1451 Species:Drosophila melanogaster
Sequence 2:NP_612552.1 Gene:Pde9a / 191569 RGDID:621035 Length:534 Species:Rattus norvegicus


Alignment Length:345 Identity:105/345 - (30%)
Similarity:173/345 - (50%) Gaps:32/345 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   791 LRRLRVPSAVHFRLHDFKFDDIHFEDDDTLKACLRMFLDLDFVERFHIDYEVLCRWLLSVKKNYR 855
            :..||.|:          ||...:|.::.|.....|:.||..|..|.|:...|.||||.|..|||
  Rat   192 IEALRKPT----------FDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPITLRRWLLCVHDNYR 246

  Fly   856 NVTYHNWRHAFNVAQMMFAILTTTQWWKIFGEIECLALIIGCLCHDLDHRGTNNSFQIKASSPLA 920
            :..:||:||.|.|.|||::::......:.|.:::.|.|:...:||||||.|.||::||.|.:.||
  Rat   247 SNPFHNFRHCFCVTQMMYSMVWLCGLQEKFSQMDILVLMTAAICHDLDHPGYNNTYQINARTELA 311

  Fly   921 QLYS-TSTMEHHHFDQCLMILNSPGNQILANLSSDDYCRVIRVLEDAILSTDLAVYFKKRGPFLE 984
            ..|: .|.:|:||......||..|...|.|::..:.:.::.:.:...||:||:|.:.:....|.|
  Rat   312 VRYNDISPLENHHCAIAFQILARPECNIFASVPPEGFRQIRQGMITLILATDMARHAEIMDSFKE 376

  Fly   985 SVSQPTSYWVAEEPRALLRAMSMTVCDLSAITKPWEIEKRVADLVSSEFFEQGDMEKQE-LNITP 1048
            .:.  ...:..||...||:.:.:..||:|...:|.|:.:...|.:..|:|.|.|.||.| |.:.|
  Rat   377 KME--NFDYSNEEHLTLLKMILIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKSEGLPVAP 439

  Fly  1049 IDIMNREKEDELPMMQVNFIDSICLPIYEAFATLSDKLEPLVEGVR-----DNRGHWIDLADVVK 1108
              .|:|:|..: ...|:.||..:.:|::|...    ||.|:||...     ::|.|:.:|     
  Rat   440 --FMDRDKVTK-ATAQIGFIKFVLIPMFETVT----KLFPIVEETMLRPLWESREHYEEL----- 492

  Fly  1109 TKTSQDQEPEEEQQQQNVIS 1128
             |...|...|.:::.:|:.|
  Rat   493 -KQLDDAMKELQKKTENLTS 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde11NP_001286044.1 GAF 420..582 CDD:214500
GAF 611..762 CDD:214500
PDEase_I 859..1094 CDD:278654 75/236 (32%)
Pde9aNP_612552.1 PDEase_I 250..478 CDD:278654 75/236 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 500..534 3/12 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.