DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde11 and Pde7a

DIOPT Version :9

Sequence 1:NP_001286044.1 Gene:Pde11 / 35107 FlyBaseID:FBgn0085370 Length:1451 Species:Drosophila melanogaster
Sequence 2:NP_001116231.1 Gene:Pde7a / 18583 MGIID:1202402 Length:482 Species:Mus musculus


Alignment Length:334 Identity:87/334 - (26%)
Similarity:158/334 - (47%) Gaps:37/334 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   803 RLHDFKFDDIHFE----DDDTLKACLRMFLDLDFVERFHIDYEVLCRWLLSVKKNYRNVT-YHNW 862
            ::.::.||...|:    .:..:.....:|.....:|.||:|...|.|:|:.::::|.:.. |||.
Mouse   150 KVGNWNFDIFLFDRLTNGNSLVSLTFHLFSLHGLIEYFHLDMVKLRRFLVMIQEDYHSQNPYHNA 214

  Fly   863 RHAFNVAQMMFAIL-------TTTQWWKIFGEIECLALIIGCLCHDLDHRGTNNSFQIKASSPLA 920
            .||.:|.|.|...|       :.|.|       :.|..:|....|||||.|.|..|.||.:..||
Mouse   215 VHAADVTQAMHCYLKEPKLASSVTPW-------DILLSLIAAATHDLDHPGVNQPFLIKTNHYLA 272

  Fly   921 QLY-STSTMEHHHFDQCLMILNSPGNQILANLSSDDYCRVIRVLEDAILSTDLAVYFKKRGPFLE 984
            .|| ::|.:|:||:...:.:|...|  :.::|..:....:...:...||:||::...:....|..
Mouse   273 TLYKNSSVLENHHWRSAVGLLRESG--LFSHLPLESRQEMEAQIGALILATDISRQNEYLSLFRS 335

  Fly   985 SVSQPTSYWVAEEPRALLRAMSMTVCDLSAITKPWEIEKRVADLVSSEFFEQGDMEKQ-ELNITP 1048
            .:.:...:......|.|:..|::...|:....:.||:.|:.::.|:.|||.|||:||: .|.::|
Mouse   336 HLDKGDLHLDDGRHRHLVLQMALKCADICNPCRNWELSKQWSEKVTEEFFHQGDIEKKYHLGVSP 400

  Fly  1049 IDIMNREKEDELPMMQVNFIDSICLPIYEAFATLSD-KLEPLVEG-VRDNRGHWIDLADVVKTKT 1111
              :.:|:.| .:..:|:.|:..:..|::..:|..|| :|...:.| |..|:..|         |.
Mouse   401 --LCDRQTE-SIANIQIGFMTYLVEPLFTEWARFSDTRLSQTMLGHVGLNKASW---------KG 453

  Fly  1112 SQDQEPEEE 1120
            .|.|:|..|
Mouse   454 LQRQQPSSE 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde11NP_001286044.1 GAF 420..582 CDD:214500
GAF 611..762 CDD:214500
PDEase_I 859..1094 CDD:278654 67/245 (27%)
Pde7aNP_001116231.1 Endonuc-BglII <51..128 CDD:286304
PDEase_I 211..431 CDD:278654 63/231 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844400
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.