DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde11 and pde7a

DIOPT Version :9

Sequence 1:NP_001286044.1 Gene:Pde11 / 35107 FlyBaseID:FBgn0085370 Length:1451 Species:Drosophila melanogaster
Sequence 2:XP_031760262.1 Gene:pde7a / 100498541 XenbaseID:XB-GENE-1013813 Length:480 Species:Xenopus tropicalis


Alignment Length:303 Identity:85/303 - (28%)
Similarity:152/303 - (50%) Gaps:38/303 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   833 VERFHIDYEVLCRWLLSVKKNYRNVT-YHNWRHAFNVAQMMFAILTTTQWWKIFGEIECLALIIG 896
            ::.|.:|...|.|:|:.|:::|.:.. |||..||.:|.|.|:..|...:..|.|...:.|..:|.
 Frog   199 IDHFQLDMVKLRRFLVMVQEDYHSQNPYHNAVHAADVTQAMYCFLKEPKLAKSFTPWDILLGLIA 263

  Fly   897 CLCHDLDHRGTNNSFQIKASSPLAQLY-STSTMEHHHFDQCLMILNSPGNQILANLSSDDYCRVI 960
            ...|||||.|.|.||.||.:..||.|| :||.:|:||:...:.:|...|  :.|:::.::...:.
 Frog   264 AATHDLDHPGVNQSFLIKTNHYLATLYKNTSVLENHHWRSAVGLLRESG--LFAHMTLEERQHME 326

  Fly   961 RVLEDAILSTDLA---VYFKK------RGPF-LESVSQPTSYWVAEEPRALLRAMSMTVCDLSAI 1015
            ..|...||:||::   .|..:      ||.. |::.|.          |..:..|::...|:...
 Frog   327 GQLGSIILATDISRQNEYLSQFRTHLDRGDLCLDNASD----------RLFILQMALKCADICNP 381

  Fly  1016 TKPWEIEKRVADLVSSEFFEQGDME-KQELNITPIDIMNREKEDELPMMQVNFIDSICLPIYEAF 1079
            .:.||:.|:.::.|:.|||.|||:| |.:|:::|  :.:|:..: :..:|:.||..:..|::..:
 Frog   382 CRTWELSKQWSEKVTEEFFYQGDVERKYKLDVSP--LCDRQTSN-IANIQIGFITYLVEPLFVEW 443

  Fly  1080 ATLSD-KLEPLVEG-VRDNRGHWIDLADVVKTKTSQDQEPEEE 1120
            |..|: :|...:.| |..|:..|..:.        |::...||
 Frog   444 ARFSNTRLSQTMLGHVGLNKASWKGML--------QERSSSEE 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde11NP_001286044.1 GAF 420..582 CDD:214500
GAF 611..762 CDD:214500
PDEase_I 859..1094 CDD:278654 72/248 (29%)
pde7aXP_031760262.1 PDEase_I 226..459 CDD:395177 72/247 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.